GJA3 Antikörper (N-Term)

Produktnummer ABIN3042423

Produktdetails anti-GJA3 Antikörper

Target: GJA3 (Gap Junction Protein, alpha 3, 46kDa (GJA3))

Bindungsspezifität: AA 89-118, N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GJA3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Gap junction alpha-3 protein(GJA3) detection. Tested with WB in Human,Mouse,Rat.

Sequenz: TLIYLGHVLH IVRMEEKKKE REEEEQLKRE

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Gap junction alpha-3 protein(GJA3) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: gap junction protein, alpha 3, 46 kDa
Protein Name: Gap junction alpha-3 protein

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human GJA3 (89-118aa TLIYLGHVLHIVRMEEKKKEREEEEQLKRE), different from the related mouse and rat sequences by four amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu GJA3

Target: GJA3 (Gap Junction Protein, alpha 3, 46kDa (GJA3))

Andere Bezeichnung: GJA3 (GJA3 Produkte)

Synonyme: cx46 antikoerper, MGC53082 antikoerper, czp3 antikoerper, Cx44 antikoerper, cx48.5 antikoerper, Cnx46 antikoerper, Cx43 antikoerper, Cx46 antikoerper, Gja-3 antikoerper, CTRCT14 antikoerper, CX46 antikoerper, CZP3 antikoerper, MGC69466 protein L homeolog antikoerper, gap junction protein alpha 3 antikoerper, gap junction protein, alpha 3 antikoerper, MGC69466.L antikoerper, gja3 antikoerper, GJA3 antikoerper, Gja3 antikoerper

Hintergrund: Gap junction alpha-3 protein, also known as Connexin-46, is a protein that in humans is encoded by the GJA3 gene. This gene is mapped to 13q12.11. The protein encoded by this gene is a connexin and is a component of lens fiber gap junctions. One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. Defects in this gene are a cause of zonular pulverulent cataract type 3 (CZP3).

Synonyms: CAE3 antibody|Connexin 46 antibody|Connexin-46 antibody|Connexin46 antibody|Cx46 antibody|CXA3_HUMAN antibody|CZP3 antibody|Gap junction alpha 3 protein antibody|Gap junction alpha-3 protein antibody|Gap junction protein, alpha 3, 46kD (connexin 46) antibody|Gap junction protein, alpha 3, 46 kDa (connexin 46) antibody|Gap junction protein, alpha 3, 46 kDa antibody|Gja3 antibody

Gen-ID: 2700

UniProt: Q9Y6H8