Heat Shock Protein 90 alpha/beta (HSP90 alpha/beta) Antikörper

Antigen: Heat Shock Protein 90 alpha/beta (HSP90 alpha/beta)

Klonalität: Polyklonal

Wirt: Huhn

Applikation: Western Blot (WB)

Produktnummer: ABIN266753

Produktbeschreibung

Weitere Bezeichnung: Heat Shock Protein 90 / HSP90 (alpha + beta)

Gen-ID: 3320, 15519, 299331

Immunogen: Synthetic peptide:NRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPI , corresponding to amino acids 454-524 of Human Hsp90.

Beschreibung: In mammalian cells there are at least two Hsp90 isoforms, Hsp90a and Hsp90b whichare encoded by separate genes. These ubiquitous and highly conserved proteinsaccount for 1-2% of all cellular proteins in most cells. Hsp90 is part of the cells powerfulnetwork of chaperones to fight the deleterious consequences of protein unfoldingcaused by nonphysiological conditions. However, in the absence of stress, Hsp90 is anecessary component of fundamental cellular processes such as hormone signaling andcell cycle control. In this context several key regulatory proteins such as steriodreceptors, cell cycle kinases involved in signal transduction and p53 have beenidentified as substrates of Hsp90. It has been suggested that Hsp90 acts as a capacitorfor morphological evolution by buffering widespread variation, which may affectmorphogenic pathways. Alternate Names: anti-Heat Shock Protein 90 antibody.

Spezifität: Species Reactivity: Cross-reacts with Human, Mouse and Rat.Not yet tested in other species. Localization: Cytoplasmic.

Anwendungen

Applikationshinweise: Predicted molecular weight: 90 kDa. May alsowork for IHC and ICC. Optimal dilutions/concentrationsshould be determined by the end user.

Buffer: PBS. Preservative: None.

Lagerung: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze thaw cycles.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Bilder

anti-Heat Shock Protein 90 alpha/beta (HSP90 alpha/beta) antibody

Publikationen

Publikationen: Liu, Zhang, Shi et al.: "Rab11a and HSP90 regulate recycling of extracellular alpha-synuclein." in: The Journal of neuroscience : the official journal of the Society for Neuroscience, Vol. 29, Issue 5, pp. 1480-5, 2009 (PubMed).