In den Warenkorb
Bestellen Sie auch über:
+33 (0)1 76 63 32 65
+33 (0)1 74 18 08 22

Calcitonin-Related Polypeptide alpha (CALCA) Antikörper

Antigen

Calcitonin-Related Polypeptide alpha (CALCA)
Synonyme CALCA, CALC3, MGC152154, CT, KC, CGRP, CALC1, CGRP1, CGRP-I, MGC126648, CFP1, CGBP, SPP1, PCCX1, PHF18, hCGBP, HsT2645, 2410002I16Rik, 5830420C16Rik, CALC, calcitonin, calca, ci-ct
Klonalität Polyklonal
Wirt
Alternativen

Kaninchen
Reaktivität
Alternativen

Human
Applikation
Alternativen Radioimmunoassay (RIA)
Produktnummer ABIN191805
Menge 100 µl  (Varianten)
Preis 330,00 €   Zzgl. Versandkosten €40,00 und MWSt
Lieferung nach
Verfügbarkeit Lieferung in 7 bis 10 Werktagen

Produktbeschreibung
Anwendungen Alternativen Sekundärantikörper Varianten zurück nach oben

Produktmerkmale Synonyms: CALCA, CALC1
Weitere Bezeichnung Calcitonin
Swiss-Prot P01258
Immunogen Synthetic human Calcitonin, BSA-conjugatedAA Sequence: CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP
Kreuzreaktivität Human
Beschreibung Calcitonin is a 32 amino acid peptide hormone synthesized by the parafollicular cells ofthe thyroid. It causes a rapid, but short lived, reduction in serum calcium and phosphateby promoting the incorporation of those ions in the bones. This effect is opposite to that ofparathyroid hormone. Staining for calcitonin may be used for the identification of aspectrum of C cell proliferative abnormalities ranging from C cell hyperplasia to invasivetumors. Staining for calcitonin in medullary carcinoma of the thyroid produces a finegranular pattern in the cytoplasm. Amyloid deposits within the tumor may also exhibitvarying degrees of calcitonin activity.
Spezifität This antibody detects Calcitonin. There were no cross reactivities obtained with human catacalcin and human CalcitoninGene related Peptide. Species: Human. Others not tested. Add. Information: LocusID 796

Anwendungen
Alternativen Sekundärantikörper Varianten zurück nach oben

Applikationshinweise RIA (1: 15,000). Other applications not tested. Optimal dilutions are dependent on conditions and should be determined by the user.
Reinigung Serum
Lagerung Store lyophilized at 2 - 8 °C and reconstituted at -20 °C. Avoid repeated freezing andthawing. Shelf life: One year from despatch.
Forschungsgebiet Krebs, Wachstumsfaktoren, Hormone, Zytoskelett, Mikrofilamente, Angeborene Immunität, Chemokine
Beschränkungen Nur für Forschungszwecke einsetzbar

Alternativen
Anwendungen Sekundärantikörper Varianten zurück nach oben

Alternativen zu Antigen "Calcitonin-Related Polypeptide alpha (CALCA)", Typ "Antikörper" finden
Wirte Kaninchen (106), Maus (43), Ziege (7), Schaf (6), Huhn (4), Meerschweinchen (2)
Reaktivitäten Human (140), Ratte (Rattus) (42), Hund (27), Maus (21), Schwein (10), Kaninchen (10), Schaf (10), Hamster (7), Affe (7), Säugetiere (4), Rind (Kuh) (3), Pferd (2), Huhn (1), Fisch (1), Meerschweinchen (1), Reptile (1), Zebrafisch (Danio rerio) (1)
Applikationen Immunfluoreszenz (IF) (50), Enzyme Immunoassay (EIA) (44), Immunhistochemie (Paraffinschnitte) (IHC (p)) (44), Western Blot (WB) (37), Durchflusszytometrie (FACS) (36), Immunhistochemie (Gefrierschnitte) (IHC (fro)) (31), Radioimmunoassay (RIA) (21), ELISA (13), Immunhistochemie (IHC) (11), Immunpräzipitation (IP) (5), Immunhistochemie (formalinfixierte Schnitte) (IHC (f)) (4), Electrophoresis (EP) (3), Dot Blot (Dot) (2), ELISA (Fangantikörper) (2), ELISA (Detektionsantikörper) (2), Immunoelectron Microscopy (IEM) (2), Immunzytochemie (ICC) (1), Neutralisierung (Neut) (1)
Konjugate Biotin (6), Alexa Flour 488 (2), Alexa Fluor 350 (2), Alexa Fluor 488 (2), Alexa Fluor 555 (2), Alexa Fluor 647 (2), Cy3 (2), Cy5 (2), Cy5.5 (2), Cy7 (2), FITC (2), Gold (2), HRP (2), PE (2), PE,Cy3 (2), PE,Cy5 (2), PE,Cy5.5 (2), PE,Cy7 (2), RBITC (2)
Epitope AA 1-32 (8), C-Term (3)