In den Warenkorb
Bestellen Sie auch über:
![]() |
+49 (0)241 95 163 153 |
![]() |
+49 (0)241 95 163 155 |
Calcitonin-Related Polypeptide alpha (CALCA) Antikörper
| Antigen | Calcitonin-Related Polypeptide alpha (CALCA) |
| Synonyme | CALCA, CALC3, MGC152154, CT, KC, CGRP, CALC1, CGRP1, CGRP-I, MGC126648, CFP1, CGBP, SPP1, PCCX1, PHF18, hCGBP, HsT2645, 2410002I16Rik, 5830420C16Rik, CALC, calcitonin, calca, ci-ct |
| Klonalität | Polyklonal |
| Wirt |
Alternativen Kaninchen |
| Reaktivität |
Alternativen Human |
| Applikation |
Alternativen Radioimmunoassay (RIA)
|
| Produktnummer | ABIN191804 |
| Menge | 20 µl (Varianten) |
| Preis | 130,00 € Zzgl. Versandkosten €20,00 und MWSt |
| Lieferung nach |
|
| Verfügbarkeit | Versandbereit innerhalb von 7 bis 10 Werktagen |
Produktbeschreibung
| Produktmerkmale | Synonyms: CALCA, CALC1 |
| Weitere Bezeichnung | Calcitonin |
| Swiss-Prot | P01258 |
| Immunogen | Synthetic human Calcitonin, BSA-conjugatedAA Sequence: CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP |
| Format | Serum |
| Beschreibung | Calcitonin is a 32 amino acid peptide hormone synthesized by the parafollicular cells ofthe thyroid. It causes a rapid, but short lived, reduction in serum calcium and phosphateby promoting the incorporation of those ions in the bones. This effect is opposite to that ofparathyroid hormone. Staining for calcitonin may be used for the identification of aspectrum of C cell proliferative abnormalities ranging from C cell hyperplasia to invasivetumors. Staining for calcitonin in medullary carcinoma of the thyroid produces a finegranular pattern in the cytoplasm. Amyloid deposits within the tumor may also exhibitvarying degrees of calcitonin activity. |
| Spezifität | This antibody detects Calcitonin. There were no cross reactivities obtained with human catacalcin and human CalcitoninGene related Peptide. Species: Human. Others not tested. Add. Information: LocusID 796 |
Anwendungen
| Applikationshinweise | RIA (1: 15,000). Other applications not tested. Optimal dilutions are dependent on conditions and should be determined by the user. |
| Lagerung | Store lyophilized at 2 - 8 °C and reconstituted at -20 °C. Avoid repeated freezing andthawing. Shelf life: One year from despatch. |
| Forschungsgebiet | Krebs, Wachstumsfaktoren, Hormone, Zytoskelett, Mikrofilamente, Angeborene Immunität, Chemokine |
| Beschränkungen | Nur für Forschungszwecke einsetzbar |
Alternativen
Alternativen zu Antigen "Calcitonin-Related Polypeptide alpha (CALCA)", Typ "Antikörper" finden




Alternativen