In den Warenkorb
Bestellen Sie auch über:
+33 (0)1 76 63 32 65
+33 (0)1 74 18 08 22

Calcitonin-Related Polypeptide alpha (CALCA) Antikörper

Antigen

Calcitonin-Related Polypeptide alpha (CALCA)
Synonyme CALCA, CALC3, MGC152154, CT, KC, CGRP, CALC1, CGRP1, CGRP-I, MGC126648, CFP1, CGBP, SPP1, PCCX1, PHF18, hCGBP, HsT2645, 2410002I16Rik, 5830420C16Rik, CALC, calcitonin, calca, ci-ct
Klonalität Polyklonal
Wirt
Alternativen

Ziege
Reaktivität
Alternativen

Human
Applikation
Alternativen Radioimmunoassay (RIA)
Produktnummer ABIN191802
Menge 20 µl  (Varianten)
Preis 140,00 €   Zzgl. Versandkosten €40,00 und MWSt
Lieferung nach
Verfügbarkeit Lieferung in 7 bis 10 Werktagen

Produktbeschreibung
Anwendungen Alternativen Sekundärantikörper Varianten zurück nach oben

Produktmerkmale Synonyms: Calcitonin gene-related peptide I, Alpha-type CGRP, CALC1, CGRP-I
Weitere Bezeichnung CGRP / CALCA
Swiss-Prot P06881
Immunogen AA Sequence: ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF
Kreuzreaktivität Human
Beschreibung CGRP is present in C-cells of the thyroid and in central and peripheral nerves. CGRP hasseveral important physiologic roles: it is a potent vasodilator, and can affect the force andrate of heart beat, it can modulate acetylcholine receptor function at the neuromuscularjunction, it has been demonstrated to block tolerance to morphine, and it can modulateantigen presentation in Langerhans cells in the skin. Despite these important physiologicfunctions, therapeutic strategies using CGRP have been impeded due to the lack of acloned CGRP receptor with which ligands could be developed.
Spezifität This antibody detects Calcitonin Gene-related Peptide. There were no cross reactivities obtained with human and salmon Katacalcin andCalcitonin. Species: Human. Others not tested. Add. Information: LocusID 797

Anwendungen
Alternativen Sekundärantikörper Varianten zurück nach oben

Applikationshinweise RIA (1: 3,000). Other applications not tested. Optimal dilutions are dependent on conditions and should be determined by the user.
Reinigung Serum
Lagerung Store lyophilized at 2 - 8 °C and reconstituted at -20 °C. Avoid repeated freezing andthawing. Shelf life: One year from despatch.
Forschungsgebiet Hormone, Neurotransmitter
Beschränkungen Nur für Forschungszwecke einsetzbar

Alternativen
Anwendungen Sekundärantikörper Varianten zurück nach oben

Alternativen zu Antigen "Calcitonin-Related Polypeptide alpha (CALCA)", Typ "Antikörper" finden
Wirte Kaninchen (107), Maus (43), Ziege (6), Schaf (6), Huhn (4), Meerschweinchen (2)
Reaktivitäten Human (140), Ratte (Rattus) (42), Hund (27), Maus (21), Schwein (10), Kaninchen (10), Schaf (10), Hamster (7), Affe (7), Säugetiere (4), Rind (Kuh) (3), Pferd (2), Huhn (1), Fisch (1), Meerschweinchen (1), Reptile (1), Zebrafisch (Danio rerio) (1)
Applikationen Immunfluoreszenz (IF) (50), Enzyme Immunoassay (EIA) (44), Immunhistochemie (Paraffinschnitte) (IHC (p)) (44), Western Blot (WB) (37), Durchflusszytometrie (FACS) (36), Immunhistochemie (Gefrierschnitte) (IHC (fro)) (31), Radioimmunoassay (RIA) (21), ELISA (13), Immunhistochemie (IHC) (11), Immunpräzipitation (IP) (5), Immunhistochemie (formalinfixierte Schnitte) (IHC (f)) (4), Electrophoresis (EP) (3), Dot Blot (Dot) (2), ELISA (Fangantikörper) (2), ELISA (Detektionsantikörper) (2), Immunoelectron Microscopy (IEM) (2), Immunzytochemie (ICC) (1), Neutralisierung (Neut) (1)
Konjugate Biotin (6), Alexa Flour 488 (2), Alexa Fluor 350 (2), Alexa Fluor 488 (2), Alexa Fluor 555 (2), Alexa Fluor 647 (2), Cy3 (2), Cy5 (2), Cy5.5 (2), Cy7 (2), FITC (2), Gold (2), HRP (2), PE (2), PE,Cy3 (2), PE,Cy5 (2), PE,Cy5.5 (2), PE,Cy7 (2), RBITC (2)
Epitope AA 1-32 (8), C-Term (3)