In den Warenkorb
Bestellen Sie auch über:
+33 (0)1 76 63 32 65
+33 (0)1 74 18 08 22

Natriuretic Peptide Precursor A (NPPA) (AA 1-30) Antikörper

Antigen

Natriuretic Peptide Precursor A (NPPA)

Synonyme ANF, ANP, PND, ATFB6, CDD-ANF, Pnd, RATANF, Anf, anf, zeh1304, MGC152837, hm:zeh1304, NPPA
Epitope
Alternativen

AA 1-30

Klonalität Polyklonal
Wirt
Alternativen

Schaf

Reaktivität
Alternativen

Human

Applikation
Alternativen Enzyme Immunoassay (EIA), Radioimmunoassay (RIA)
Produktnummer ABIN191642
Menge 100 µl
Preis 420,00 €   Zzgl. Versandkosten €40,00 und MWSt
Lieferung nach
Verfügbarkeit Lieferung in 7 bis 10 Werktagen

Produktbeschreibung

Produktmerkmale Synonyms: Atrial Natriuretic Peptide, Prepronatriodilatin, NPPA, ANP, PND
Weitere Bezeichnung Atrial Natriuretic Factor (ANF)
Swiss-Prot P01160
Immunogen Synthetic human pro-ANP (aa 1-30) poly Lysin conjugatedAA Sequence: NPMYNAVSNADLMDFKNLLDHLEEKMPLED
Kreuzreaktivität Human
Beschreibung Atrial natriuretic factor (ANP) is a potent vasoactive substance which is thought to play akey role in cardiovascular homeostasis and has a cGMP stimulating activity. There are twodifferent prepronatriodilatin alleles. One codes for 2 Arginine residues at the C terminusthat are cleaved to form the mature peptide, while the other ends in a termination codonimmediately after the last codon of the mature peptide. ANP belongs to the natriureticpeptide family.
Spezifität This antibody detects Synthetic pro-ANP (aa 1-30). There were no cross reactivities obtained with human pro-ANP (aa 31-67, 67-98) andhuman ANP (aa 1-28). Species: Human. Others not tested. Add. Information: Reference no. : LocusID 4878

Anwendungen

Applikationshinweise RIA (1: 5000). ELISA. Other applications not tested. Optimal dilutions are dependent on conditions and should be determined by the user.
Reinigung Serum
Lagerung Store lyophilized at 2-8°C and reconstituted at -20°C. Avoid repeated freezing and thawing. Shelf life: One year from despatch.
Beschränkungen Nur für Forschungszwecke einsetzbar

Alternativen

Alternativen zu Antigen "Natriuretic Peptide Precursor A (NPPA)", Typ "Antikörper" finden
Wirte Kaninchen (19), Maus (6), Schaf (4)
Reaktivitäten Human (26), Ratte (Rattus) (9), Maus (6), Kaninchen (1), Schaf (1)
Applikationen Enzyme Immunoassay (EIA) (13), Radioimmunoassay (RIA) (11), Western Blot (WB) (8), ELISA (6), Immunpräzipitation (IP) (4), Immunhistochemie (Gefrierschnitte) (IHC (fro)) (3), Immunhistochemie (IHC) (2), Immunhistochemie (Paraffinschnitte) (IHC (p)) (2), Immunfluoreszenz (IF) (1)
Epitope ANP 1-28 (12), AA 1-28 (6), AA 1-151 (1), N-Term (1)