Natriuretic Peptide Precursor A (NPPA) (AA 1-30) Antikörper

Antigen: Natriuretic Peptide Precursor A (NPPA)

Synonyme: ANF, ANP, PND, ATFB6, CDD-ANF, Pnd, RATANF, Anf, anf, zeh1304, MGC152837, hm:zeh1304, NPPA

Epitope: AA 1-30

Klonalität: Polyklonal

Wirt: Schaf

Reaktivität: Human

Applikation: Enzyme Immunoassay (EIA), Radioimmunoassay (RIA)

Produktnummer: ABIN191641

Produktbeschreibung

Produktmerkmale: Synonyms: CDP, ANF, NPPA, PND, Prepronatriodilatin

Weitere Bezeichnung: Atrial Natriuretic Factor (ANF)

Swiss-Prot: P01160

Immunogen: Synthetic human pro-ANP (aa 1-30) poly Lysin conjugatedAA Sequence: NPMYNAVSNADLMDFKNLLDHLEEKMPLED

Kreuzreaktivität: Human

Beschreibung: Atrial natriuretic factor (ANP) is a potent vasoactive substance which is thought to play akey role in cardiovascular homeostasis and has a cGMP stimulating activity. There are twodifferent prepronatriodilatin alleles. One codes for 2 Arginine residues at the C terminusthat are cleaved to form the mature peptide, while the other ends in a termination codonimmediately after the last codon of the mature peptide. ANP belongs to the natriureticpeptide family.

Spezifität: This antibody detects Synthetic pro-ANP (aa 1-30). There were no cross reactivities obtained with human pro-ANP (aa 31-67, 67-98) andhuman ANP (aa 1-28). Species: Human. Others not tested. Add. Information: Reference no. : LocusID 4878

Anwendungen

Applikationshinweise: RIA (1: 5000). ELISA. Other applications not tested. Optimal dilutions are dependent on conditions and should be determined by the user.

Reinigung: Serum

Lagerung: Store lyophilized at 2-8°C and reconstituted at -20°C. Avoid repeated freezing and thawing. Shelf life: One year from despatch.

Beschränkungen: Nur für Forschungszwecke einsetzbar