In den Warenkorb
Bestellen Sie auch über:
+49 (0)241 95 163 153
+49 (0)241 95 163 155

Atrial Natriuretic Factor (ANF) (1-30) Antikörper

Antigen

Atrial Natriuretic Factor (ANF) (1-30)

Klonalität Polyklonal
Wirt

Schaf

Reaktivität

Human

Applikation
Enzyme Immunoassay (EIA), Radioimmunoassay (RIA)
Produktnummer ABIN191641
Menge 20 µl  (Varianten)
Preis 110,00 €   Zzgl. Versandkosten €20,00 und MWSt
Lieferung nach
Verfügbarkeit Versandbereit innerhalb von 7 bis 10 Werktagen

Produktbeschreibung

Produktmerkmale Synonyms: CDP, ANF, NPPA, PND, Prepronatriodilatin
Swiss-Prot P01160
Immunogen Synthetic human pro-ANP (aa 1-30) poly Lysin conjugatedAA Sequence: NPMYNAVSNADLMDFKNLLDHLEEKMPLED
Format Serum
Beschreibung Atrial natriuretic factor (ANP) is a potent vasoactive substance which is thought to play akey role in cardiovascular homeostasis and has a cGMP stimulating activity. There are twodifferent prepronatriodilatin alleles. One codes for 2 Arginine residues at the C terminusthat are cleaved to form the mature peptide, while the other ends in a termination codonimmediately after the last codon of the mature peptide. ANP belongs to the natriureticpeptide family.
Spezifität This antibody detects Synthetic pro-ANP (aa 1-30). There were no cross reactivities obtained with human pro-ANP (aa 31-67, 67-98) andhuman ANP (aa 1-28). Species: Human. Others not tested. Add. Information: Reference no. : LocusID 4878

Anwendungen

Applikationshinweise RIA (1: 5000). ELISA. Other applications not tested. Optimal dilutions are dependent on conditions and should be determined by the user.
Lagerung Store lyophilized at 2-8°C and reconstituted at -20°C. Avoid repeated freezing and thawing. Shelf life: One year from despatch.
Beschränkungen Nur für Forschungszwecke einsetzbar