WD Repeat and SOCS Box-containing 1 (WSB1) Antikörper

Antigen: WD Repeat and SOCS Box-containing 1 (WSB1)

Synonyme: SWIP1, WSB-1, 1110056B13Rik, 2700038M07Rik, MGC112712, zgc:63905, wu:fb92g11, wsb1, MGC75613, SWIP-1, WSB1, LOC100221333

Klonalität: Polyklonal

Wirt: Maus

Reaktivität: Human

Applikation: Western Blot (WB), ELISA

Zertifikate: ISO 9001:2008

Produktnummer: ABIN172341

Produktbeschreibung

Gen-ID: 26118

Immunogen: WSB1 (NP_056441, 101 a.a. ~ 201 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) EHIIDCGDIVWSLAFGSSVPEKQSRCVNIEWHRFRFGQDQLLLATGLNNGRIKIW DVYTGKLLLNLVDHTEVVRDLTFAPDGSLILVSASRDKTLRVWDL*

Beschreibung: WD repeat and SOCS box-containing 1 This gene encodes a member of the WD-protein subfamily. This protein shares a high sequence identity to mouse and chick proteins. It contains several WD-repeats spanning most of the protein and an SOCS box in the C-terminus. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. Mouse polyclonal antibody raised against a partial recombinant WSB1. Synonyms: SWIP1, WSB-1

Anwendungen

Applikationshinweise: Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Buffer: In 50% Glycerol Western Blot detection against Immunogen (36.74 KDa) .

Lagerung: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Bilder

Western Blot detection against Immunogen (36.74 KDa) .