In den Warenkorb
Bestellen Sie auch über:
+49 (0)241 95 163 153
+49 (0)241 95 163 155

K(lysine) Acetyltransferase 6B (KAT6B) Antikörper

Antigen

K(lysine) Acetyltransferase 6B (KAT6B)

Synonyme qkf, MORF, MOZ2, KAT6B, FLJ90335, KIAA0383, querkopf, DKFZp313G1618, id:ibd5103
Klonalität Polyklonal
Wirt
Reaktivität
Alternativen

Human

Applikation
Alternativen Western Blot (WB), ELISA
Zertifikate ISO 9001:2008
Produktnummer ABIN172279
Menge 50 µl
Preis 240,00 €   Zzgl. Versandkosten €20,00, €20,00 Trockeneispauschale sowie MWSt
Lieferung nach
Verfügbarkeit Lieferbar innerhalb von 5 bis 10 Werktagen

Produktbeschreibung

Weitere Bezeichnung MYST histone acetyltransferase (monocytic leukemia) 4 (MYST4)
Gen-ID 23522
Immunogen MYST4 (NP_036462, 80 a.a. ~ 173 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) FSSVKPGTFPKSAKGSRGSCNDLRNVDWNKLLRRAIEGLEEPNGSSLKNIEKYLR SQSDLTSTTNNPAFQQRLRLGAKRAVNNGRLLKDGPQY*
Beschreibung MYST histone acetyltransferase (monocytic leukemia) 4 Mouse polyclonal antibody raised against a partial recombinant MYST4. Synonyms: DKFZp313G1618, KIAA0383, MORF, MOZ2, qkf, querkopf

Anwendungen

Applikationshinweise Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 50% Glycerol Western Blot detection against Immunogen (36.34 KDa) .
Lagerung Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Beschränkungen Nur für Forschungszwecke einsetzbar

Alternativen

Alternativen zu Antigen "K(lysine) Acetyltransferase 6B (KAT6B)", Typ "Antikörper" finden
Wirte Kaninchen (2)
Reaktivitäten Rind (Kuh) (1), Human (1)
Applikationen Immunhistochemie (IHC) (2), Western Blot (WB) (2), ELISA (1), Immunpräzipitation (IP) (1)
Epitope N-Term (1)