WW Domain Containing E3 Ubiquitin Protein Ligase 2 (WWP2) Antikörper

Antigen: WW Domain Containing E3 Ubiquitin Protein Ligase 2 (WWP2)

Synonyme: AIP2, WWp2-like, AA690238, AW554328, 1300010O06Rik, WWP2, MGC142390, wwp2, id:ibd1121, wu:fo87e10, aip2, wwp2-like

Klonalität: Polyklonal

Wirt: Maus

Reaktivität: Human

Applikation: Western Blot (WB), ELISA

Zertifikate: ISO 9001:2008

Produktnummer: ABIN172110

Produktbeschreibung

Gen-ID: 11060

Immunogen: WWP2 (NP_008945, 1 a.a. ~ 111 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) MASASSSRAGVALPFEKSQLTLKVVSAKPKVHNRQPRINSYVEVAVDGLPSETKK TGKRIGSSELLWNEIIILNVTAQSHLDLKVWSCHTLRNELLGTASVNLSNVLKNN *

Beschreibung: WW domain containing E3 ubiquitin protein ligase 2 This gene encodes a member of the NEDD4-like protein family. The family of proteins is known to possess ubiquitin-protein ligase activity. The encoded protein contains 4 tandem WW domains. The WW domain is a protein motif consisting of 35 to 40 amino acids and is characterized by 4 conserved aromatic residues. The WW domain may mediate specific protein-protein interactions. Three alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. Mouse polyclonal antibody raised against a partial recombinant WWP2. Synonyms: AIP2

Anwendungen

Applikationshinweise: Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Buffer: In 50% Glycerol Western Blot detection against Immunogen (38.21 KDa) .

Lagerung: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Bilder

Western Blot detection against Immunogen (38.21 KDa) .