In den Warenkorb
Bestellen Sie auch über:
+49 (0)241 95 163 153
+49 (0)241 95 163 155

S-Adenosylhomocysteine Hydrolase-Like 1 (AHCYL1) Antikörper

Antigen

S-Adenosylhomocysteine Hydrolase-Like 1 (AHCYL1)

Synonyme DCAL, IRBIT, PRO0233, XPVKONA, Irbit, AA409031, AA414901, Ahcy-rs3, 1110034F20Rik, AHCYL1, ahcyl1, cb586, MGC64088, wu:fj66f02
Klonalität Polyklonal
Wirt
Reaktivität
Alternativen

Human

Applikation
Alternativen Western Blot (WB), ELISA
Zertifikate ISO 9001:2008
Produktnummer ABIN172058
Menge 50 µl  (Varianten)
Preis 240,00 €   Zzgl. Versandkosten €20,00, €20,00 Trockeneispauschale sowie MWSt
Lieferung nach
Verfügbarkeit Lieferbar innerhalb von 5 bis 10 Werktagen

Produktbeschreibung

Gen-ID 10768
Immunogen AHCYL1 (NP_006612, 1 a.a. ~ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQEFTKFP TKTGRRSLSRSISQSSTDSYSSAASYTDSSDDEVSPREKQQTNSKG*
Beschreibung S-adenosylhomocysteine hydrolase-like 1 Mouse polyclonal antibody raised against a partial recombinant AHCYL1. Synonyms: DCAL, IRBIT, PRO0233, XPVKONA

Anwendungen

Applikationshinweise Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 50% Glycerol Western Blot detection against Immunogen (37.22 KDa) .
Lagerung Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Beschränkungen Nur für Forschungszwecke einsetzbar

Alternativen

Alternativen zu Antigen "S-Adenosylhomocysteine Hydrolase-Like 1 (AHCYL1)", Typ "Antikörper" finden
Wirte Maus (1)
Reaktivitäten Human (1)
Applikationen ELISA (1), Immunhistochemie (IHC) (1), Western Blot (WB) (1)