In den Warenkorb
Bestellen Sie auch über:
+49 (0)241 95 163 153
+49 (0)241 95 163 155

Chromosome X Open Reading Frame 6 (CXORF6) Antikörper

Antigen

Chromosome X Open Reading Frame 6 (CXORF6)

Synonyme MAMLD1, CXorf6
Klonalität Polyklonal
Wirt

Maus

Reaktivität

Human

Applikation
Western Blot (WB), ELISA
Zertifikate ISO 9001:2008
Produktnummer ABIN171873
Menge 50 µl
Preis 240,00 €   Zzgl. Versandkosten €20,00, €20,00 Trockeneispauschale sowie MWSt
Lieferung nach
Verfügbarkeit Lieferbar innerhalb von 5 bis 10 Werktagen

Produktbeschreibung

Gen-ID 10046
Immunogen CXorf6 (NP_005482, 603 a.a. ~ 702 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) SPSNITHVDKACKLGEARHPQVSLGRQPPSCQALGSESFLPGSSFAHELARVTSS YSTSEAAPWGSWDPKAWRQVPAPLLPSCDATARGTEIRSYGNDP*
Beschreibung Chromosome X open reading frame 6 Mouse polyclonal antibody raised against a partial recombinant CXorf6. Synonyms: CG1, F18

Anwendungen

Applikationshinweise Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 50% Glycerol Western Blot detection against Immunogen (37.00 KDa) .
Lagerung Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Beschränkungen Nur für Forschungszwecke einsetzbar