Kynureninase (L-Kynurenine Hydrolase) (KYNU) Antikörper

Antigen: Kynureninase (L-Kynurenine Hydrolase) (KYNU)

Klonalität: Polyklonal

Wirt: Maus

Reaktivität: Human

Applikation: Western Blot (WB), ELISA

Zertifikate: ISO 9001:2008

Produktnummer: ABIN171666

Produktbeschreibung

Gen-ID: 8942

Immunogen: KYNU (NP_003928, 2 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) EPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPKIQDLPP VDLSLVNKDENAIYFLGNSLGLQPKMVKTYLEEELDKWAKIAAYGHEVGKRP*

Beschreibung: Kynureninase (L-kynurenine hydrolase) Kynureninase is a pyridoxal-5'-phosphate (pyridoxal-P) dependent enzyme that catalyzes the cleavage of L-kynurenine and L-3-hydroxykynurenine into anthranilic and 3-hydroxyanthranilic acids, respectively. Kynureninase is involved in the biosynthesis of NAD cofactors from tryptophan through the kynurenine pathway. Two transcript variants encoding different isoforms have been found for this gene. Mouse polyclonal antibody raised against a partial recombinant KYNU.

Anwendungen

Applikationshinweise: Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Buffer: In 50% Glycerol Western Blot detection against Immunogen (37.88 KDa) .

Lagerung: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Bilder

Western Blot detection against Immunogen (37.88 KDa) .