S-Adenosylhomocysteine Hydrolase-Like 1 (AHCYL1) Antikörper

Antigen: S-Adenosylhomocysteine Hydrolase-Like 1 (AHCYL1)

Synonyme: DCAL, IRBIT, PRO0233, XPVKONA, Irbit, AA409031, AA414901, Ahcy-rs3, 1110034F20Rik, AHCYL1, ahcyl1, cb586, MGC64088, wu:fj66f02

Klonalität: Monoklonal (5D6)

Wirt: Maus

Reaktivität: Human

Applikation: Western Blot (WB), Immunhistochemie (IHC), ELISA

Zertifikate: ISO 9001:2008

Produktnummer: ABIN168432

Produktbeschreibung

Gen-ID: 10768

Immunogen: AHCYL1 (NP_006612, 1 a.a. ~ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQEFTKFP TKTGRRSLSRSISQSSTDSYSSAASYTDSSDDEVSPREKQQTNSKG*

Isotyp: IgG2b-kappa  (Passende Sekundärantikörper)

Klon: 5D6

Beschreibung: S-adenosylhomocysteine hydrolase-like 1 Mouse monoclonal antibody raised against a partial recombinant AHCYL1. Synonyms: DCAL, IRBIT, PRO0233, XPVKONA

Anwendungen

Applikationshinweise: Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Buffer: In 1x PBS, pH 7.2 Western Blot detection against Immunogen (37.22 KDa) .

Lagerung: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Bilder

Western Blot detection against Immunogen (37.22 KDa) .

Immunoperoxidase of monoclonal antibody to AHCYL1 (H00010768-M05) on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]

The detection limit for recombinant GST tagged AHCYL1 is approximately 0.1ng/ml as a capture antibody.