WAP Four-Disulfide Core Domain 2 (WFDC2) Antikörper

Antigen: WAP Four-Disulfide Core Domain 2 (WFDC2)

Synonyme: HE4, WAP5, EDDM4, MGC57529, dJ461P17.6, 1600023A02Rik, re4, WFDC2, CE4, WFDC3, MGC127126, BE-20

Klonalität: Monoklonal (3F9)

Wirt: Maus

Reaktivität: Human

Applikation: ELISA, Western Blot (WB)

Zertifikate: ISO 9001:2008

Produktnummer: ABIN168338

Produktbeschreibung

Gen-ID: 10406

Immunogen: WFDC2 (AAH46106, 31 a.a. ~ 125 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNI NFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF*

Isotyp: IgG2b-kappa  (Passende Sekundärantikörper)

Klon: 3F9

Beschreibung: WAP four-disulfide core domain 2 This gene generates multiple alternatively spliced transcript variants, which encode different protein isoforms. These isoforms contain one or two WAP-type four-disulfide core (WFDC) domains, and are thus members of the WFDC domain family. The WFDC domain, or WAP Signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. This gene is expressed in pulmonary epithelial cells, and was also found to be expressed in some ovarian cancers. The encoded isoforms are small secretory proteins, which may be involved in sperm maturation. Mouse monoclonal antibody raised against a full length recombinant WFDC2. Synonyms: HE4, MGC57529, WAP5, dJ461P17.6

Anwendungen

Applikationshinweise: Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Buffer: In 1x PBS, pH 7.2 Western Blot detection against Immunogen (36.45 KDa) .

Lagerung: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Bilder

Western Blot detection against Immunogen (36.45 KDa) .

The detection limit for recombinant GST tagged WFDC2 is approximately 0.03ng/ml as a capture antibody.