S-Phase Kinase-Associated Protein 1 (SKP1) Antikörper

Antigen: S-Phase Kinase-Associated Protein 1 (SKP1)

Synonyme: OCP2, p19A, EMC19, SKP1A, OCP-II, TCEB1L, MGC34403

Klonalität: Monoklonal (1H8)

Wirt: Maus

Reaktivität: Human

Applikation: Western Blot (WB), ELISA

Zertifikate: ISO 9001:2008

Produktnummer: ABIN167424

Produktbeschreibung

Weitere Bezeichnung: S-phase kinase-associated protein 1A (p19A) (SKP1A)

Gen-ID: 6500

Immunogen: SKP1A (NP_008861, 53 a.a. ~ 161 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) AILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAA NYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVGSTQFCL*

Isotyp: IgG2a-kappa  (Passende Sekundärantikörper)

Klon: 1H8

Beschreibung: S-phase kinase-associated protein 1A (p19A) This gene encodes an F-box protein which functions as a substrate recognition component of the SCF ubiquitin ligase complex. It binds to cyclin F, S-phase kinase-associated protein 2, and other regulatory proteins involved in ubiquitin proteolysis through an F-box motif. The encoded protein also collaborates with a network of proteins to control beta-catenin levels and affects the activity level of beta-catenin dependent TCF transcription factors. Studies have also characterized the protein as an RNA polymerase II elongation factor. Alternative splicing of this gene results in two transcript variants. A related pseudogene has been identified on chromosome 7. Mouse monoclonal antibody raised against a partial recombinant SKP1A. Synonyms: EMC19, MGC34403, OCP-II, OCP2, SKP1, TCEB1L

Anwendungen

Applikationshinweise: Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Buffer: In 1x PBS, pH 7.2 Western Blot detection against Immunogen (37.99 KDa) .

Lagerung: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Bilder

Western Blot detection against Immunogen (37.99 KDa) .