You are viewing an incomplete version of our website. Please click to reload the website as full version.

ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 9 (ABCC9) (AA 1505-1546) Antikörper

Details zu Produkt Nr. ABIN1304974, Anbieter: Anmelden zum Anzeigen Neu
Request Mehr Daten zu diesem Produkt gewünscht?

Unabhängige Labortests können diese liefern Mehr

Synonyme SUR2B, DDBDRAFT_0215814, DDBDRAFT_0216237, DDB_0215814, DDB_0216237, si:dkey-183c2.3, sur2, ABC37, ATFB12, CANTU, CMD1O, SUR2, SUR2A, AI414027, AI449286, Sur2, ABCC9
AA 1505-1546
(37), (36), (18), (17), (15), (10), (2), (2), (1), (1), (1)
Maus, Ratte (Rattus)
(51), (33), (29), (3), (2), (2), (1), (1), (1), (1)
(39), (29), (4)
Klonalität (Klon)
Monoklonal ()
(4), (4), (4), (4), (4), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Immunocytochemistry (ICC), Immunohistochemistry (IHC), Western Blotting (WB)
(64), (43), (38), (22), (20), (2)
Pubmed 1 Publikation vorhanden
Hersteller Anmelden zum Anzeigen Neu
Produkt-ID vom Hersteller Anmelden zum Anzeigen Neu
Menge 5 mL
Lieferung nach Deutschland ( )
Verfügbarkeit Lieferung in 6 bis 11 Werktagen
Klon N319A-14
Isotyp IgG2a
Kreuzreaktivität (Details) Does not cross-react with SUR2B
Rat: 97 % identity (41/42 amino acids identical)
Human: 97 % identity (39/42 amino acids identical)
107 % identity with SUR2C
< 57 % identity with SUR2B
Produktmerkmale Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A (also known as Sulfonylurea receptor 2A, ATP-binding cassette transporter sub-family C member 9A and Abcc9A)
Reinigung TC Supernatant
Andere Bezeichnung SUR2A (ABCC9 Antibody Abstract)
UniProt P70170
Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Produkt verwendet in: Hong, Bao, Kefaloyianni et al.: "Heterogeneity of ATP-sensitive K+ channels in cardiac myocytes: enrichment at the intercalated disk." in: The Journal of biological chemistry, Vol. 287, Issue 49, pp. 41258-67, 2012 (PubMed).

Produktnummer ABIN1304974
326,50 €
Zzgl. Versandkosten 20,00 € und MWSt

Bestellen Sie auch über:

  • +49 (0)241 95 163 153
  • +49 (0)241 95 163 155