You are viewing an incomplete version of our website. Please click to reload the website as full version.

ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 9 (ABCC9) (AA 1505-1546) Antikörper

Details zu Produkt Nr. ABIN1304974, Anbieter: Anmelden zum Anzeigen
  • SUR2B
  • DDBDRAFT_0215814
  • DDBDRAFT_0216237
  • DDB_0215814
  • DDB_0216237
  • si:dkey-183c2.3
  • sur2
  • ABC37
  • ATFB12
  • CMD1O
  • SUR2
  • SUR2A
  • AI414027
  • AI449286
  • Sur2
  • ABCC9
AA 1505-1546
Maus, Ratte (Rattus)
Klonalität (Klon)
Monoklonal ()
Immunocytochemistry (ICC), Immunohistochemistry (IHC), Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Teilen Sie Ihre Ergebnisse, helfen Sie anderen Wissenschaftlern und erhalten Sie den vollen Produktpreis zurück.

Validieren Sie ein Produkt

Mehr erfahren

Klon N319A-14
Isotyp IgG2a
Kreuzreaktivität (Details) Does not cross-react with SUR2B
Rat: 97 % identity (41/42 amino acids identical)
Human: 97 % identity (39/42 amino acids identical)
107 % identity with SUR2C
< 57 % identity with SUR2B
Produktmerkmale Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A (also known as Sulfonylurea receptor 2A, ATP-binding cassette transporter sub-family C member 9A and Abcc9A)
Reinigung TC Supernatant
Andere Bezeichnung SUR2A (ABCC9 Antibody Abstract)
UniProt P70170
Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Produkt verwendet in: Hong, Bao, Kefaloyianni et al.: "Heterogeneity of ATP-sensitive K+ channels in cardiac myocytes: enrichment at the intercalated disk." in: The Journal of biological chemistry, Vol. 287, Issue 49, pp. 41258-67, 2012 (PubMed).