BNP Antikörper (AA 1-32)

Produktnummer ABIN108783

Der Maus Monoklonal anti-BNP Antikörper (Klon 17-16) (ABIN108783) detektiert spezifisch BNP in ELISA. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für BNP Antikörper (AA 1-32) (ABIN108783)

Target: BNP (Brain Natriuretic Peptide (BNP))

Reaktivität: Human

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser BNP Antikörper ist unkonjugiert

Applikation: ELISA

Klon: 17-16

Produktdetails anti-BNP Antikörper

Bindungsspezifität: AA 1-32

Spezifität: Synthetic human BNP (aa 1-32) Human proBNP (aa 1-108), recombinant

Immunogen: Synthetic human BNP (aa 1-32) KLH conjugated (spkmvqgsgcfgrkmdrissssglgckvlrrh)

Isotyp: IgG1

Anwendungsinformationen

Applikationshinweise: ELISA This antibody has not been tested for use in all applications. This does not necessarily exclude its use for non-tested procedures. The stated dilutions are recommendations only. We suggest that the applicant titrates the antibody in his/her system using appropriate negative/positive controls.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Resuspend in aqua bidest.

Lagerung: 4 °C

Details zu BNP

Target: BNP (Brain Natriuretic Peptide (BNP))

Andere Bezeichnung: Brain Natriuretic Peptide

Hintergrund: Cell culture supernatant protein G purified in PBS pH 74

Pathways: Hormone Activity