anti-Human TMEM173 Antikörper für Western Blotting

Recommended TMEM173 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Transmembrane Protein 173 (TMEM173) Antikörper
  • ERIS
  • MITA
  • MPYS
  • NET23
  • STING
  • 2610307O08Rik
  • Mita
  • RGD1562552
  • transmembrane protein 173
  • TMEM173
  • Tmem173
Epitop
AA 284-316, C-Term
18
13
10
5
5
5
5
2
2
2
2
2
1
1
Reaktivität
Human
135
40
29
2
2
1
1
1
1
1
1
Wirt
Kaninchen
96
46
Klonalität
Polyklonal
Konjugat
Dieser TMEM173 Antikörper ist unkonjugiert
6
6
3
3
3
3
3
3
2
2
2
2
2
1
1
1
1
1
1
1
Applikation
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
97
51
48
41
19
15
13
13
10
7
4
4
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Bilder

Produktnummer ABIN3043423
340,48 €
Zzgl. Versandkosten 20,00 € und MWSt
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
3.3459496 ABIN2783202 WB Rabbit Middle Region Anmelden zum Anzeigen Polyclonal 4
3.3459496 ABIN955253 EIA FACS IHC (p) WB Rabbit Ig AA 318-348, C-Term Anmelden zum Anzeigen Polyclonal 4
3.3459496 ABIN955254 EIA FACS WB Rabbit Ig C-Term, AA 318-348 Anmelden zum Anzeigen Polyclonal 2
3.3459496 ABIN2787917 WB Rabbit C-Term Anmelden zum Anzeigen Polyclonal
3.3459496 ABIN4899624 FACS ICC WB Mouse IgG2b AA 215-379 Anmelden zum Anzeigen 723505 2
3.3459496 ABIN4356573 ICC IF IHC IHC (p) WB Rabbit Anmelden zum Anzeigen Polyclonal 12
3.3459496 ABIN3187979 ELISA IHC (p) WB Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal
3.3459496 ABIN2459160 ELISA WB Rabbit Anmelden zum Anzeigen Polyclonal
3.3459496 ABIN1875116 FACS IF IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
3.3459496 ABIN1860779 ICC IHC IP WB Rabbit IgG AA 159-373 Anmelden zum Anzeigen Polyclonal
3.3459496 ABIN630932 WB Rabbit Middle Region Anmelden zum Anzeigen Polyclonal
3.3459496 ABIN3029261 FACS IHC ELISA WB Rabbit Ig Fraction AA 311-340 Anmelden zum Anzeigen Polyclonal
3.3459496 ABIN3029260 FACS ELISA WB Rabbit Ig Fraction AA 311-340 Anmelden zum Anzeigen Polyclonal
3.3459496 ABIN4356582 IHC IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
3.3459496 ABIN1030523 ICC ELISA WB Rabbit C-Term Anmelden zum Anzeigen Polyclonal
3.3459496 ABIN3017834 IHC WB Rabbit Anmelden zum Anzeigen Polyclonal
1 ABIN5555020 EIA IF WB Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal
1 ABIN463618 WB Rabbit IgG AA 216-265 Anmelden zum Anzeigen Polyclonal
1 ABIN1501423 FACS WB Mouse IgG1 Anmelden zum Anzeigen 2C9
1 ABIN1501424 FACS WB Mouse IgG1 Anmelden zum Anzeigen 1G5

anti-TMEM173 Antikörper für Western Blotting mit den meisten Publikationen

Ähnliche anti-TMEM173 Antikörper

Applikation / Reaktivität Human
ELISA 46 Antikörper
Enzyme Immunoassay (EIA) 4 Antikörper
Flow Cytometry (FACS) 48 Antikörper
Immunochromatography (IC) 1 Antikörper
Immunocytochemistry (ICC) 13 Antikörper
Immunofluorescence (IF) 13 Antikörper
Immunofluorescence (fixed cells) (IF/ICC) 2 Antikörper
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13 Antikörper
Immunohistochemistry (IHC) 37 Antikörper
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 20 Antikörper
Immunoprecipitation (IP) 5 Antikörper
Luminex Assay (LMNX) 10 Antikörper
Western Blotting (WB) 91 Antikörper

General

Antigen Transmembrane Protein 173 (TMEM173) Antikörper
Epitop AA 284-316, C-Term
(18), (13), (10), (5), (5), (5), (5), (2), (2), (2), (2), (2), (1), (1)
Reaktivität Human
(135), (40), (29), (2), (2), (1), (1), (1), (1), (1), (1)
Wirt Kaninchen
(96), (46)
Klonalität
Polyklonal
Konjugat Dieser TMEM173 Antikörper ist unkonjugiert
(6), (6), (3), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(97), (51), (48), (41), (19), (15), (13), (13), (10), (7), (4), (4), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-TMEM173 Antikörper

Target Details TMEM173 Anwendungsinformationen Handhabung Bilder
Verwendungszweck Rabbit IgG polyclonal antibody for Stimulator of interferon genes protein (TMEM173) detection. Tested with WB, IHC-P in Human.
Sequenz RLEQAKLFCR TLEDILADAP ESQNNCRLIA YQE
Kreuzreaktivität (Details) No cross reactivity with other proteins.
Produktmerkmale Rabbit IgG polyclonal antibody for Stimulator of interferon genes protein (TMEM173) detection. Tested with WB, IHC-P in Human.
Gene Name: transmembrane protein 173
Protein Name: Stimulator of interferon genes protein
Reinigung Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human TMEM173 (284-316aa RLEQAKLFCRTLEDILADAPESQNNCRLIAYQE), different from the related mouse sequence by five amino acids.
Isotyp IgG

Target Details TMEM173

Produktdetails anti-TMEM173 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung TMEM173 (TMEM173 Antibody Abstract)
Hintergrund Transmembrane protein 173 is a protein that in humans is encoded by the TMEM173 gene. This gene encodes a five transmembrane protein that functions as a major regulator of the innate immune response to viral and bacterial infections. The encoded protein is a pattern recognition receptor that detects cytosolic nucleic acids and transmits signals that activate type I interferon responses. Also the encoded protein has been shown to play a role in apoptotic signaling by associating with type II major histocompatibility complex. Mutations in this gene are the cause of infantile-onset STING-associated vasculopathy. Alternate splicing results in multiple transcript variants.

Synonyms: endoplasmic reticulum IFN stimulator antibody|Endoplasmic reticulum interferon stimulator antibody|ERIS antibody|FLJ38577 antibody|hMITA antibody|hSTING antibody|Mediator of IRF3 activation antibody|MITA antibody|Mitochondrial mediator of IRF3 activation antibody|MPYS antibody|N terminal methionine proline tyrosine serine plasma membrane tetraspanner antibody|NET23 antibody|Stimulator of interferon genes antibody|Stimulator of interferon genes protein antibody|STING antibody|TM173_HUMAN antibody|Tmem173 antibody|Transmembrane protein 173 antibody
Gen-ID 340061
Forschungsgebiet Immunology, Innate Immunity, Cytokines
Pathways Activation of Innate immune Response

Anwendungsinformationen

Produktdetails anti-TMEM173 Antikörper Target Details TMEM173 Handhabung Bilder zurück nach oben
Applikationshinweise WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
Kommentare

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-TMEM173 Antikörper Target Details TMEM173 Anwendungsinformationen Bilder zurück nach oben
Format Lyophilized
Rekonstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Konzentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handhabung Avoid repeated freezing and thawing.
Lagerung 4 °C/-20 °C
Informationen zur Lagerung At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Bilder

Produktdetails anti-TMEM173 Antikörper Target Details TMEM173 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-TMEM173 Antikörper (Transmembrane Protein 173) (AA 284-316) (ABIN3043423) Anti- TMEM173 Picoband antibody, IHC(P) IHC(P): Human Lung Cancer Tissue
Western Blotting (WB) image for anti-TMEM173 Antikörper (Transmembrane Protein 173) (AA 284-316) (ABIN3043423) Observed bind size: 42KD
'Independent Validation' Siegel
Antigen Anti-TMEM173 Picoband™ Antibody
Chargennummer 0951512Da071365
Validierte Anwendung Immunohistochemistry
Positivkontrolle Human pancreatic adenocarcinoma (PDAC)
Bewertung In primary human pancreatic tumor tissue, ABIN3043423 stains specifically the tumor cell cytoplasm only, not fibroblasts.
Primärantikörper ABIN3043423
Sekundärantikörper Biotin-SP-AffinPure Donkey-anti-rabbit IgG (H+L), Jackson ImmunoResearch, cat#711-065-152
Protokoll
  • Deparaffinize slides
    • Bake slides in oven at 60°C for 1h and let cool completely to RT.
    • Rehydrate:
    • Xylene 3x 5min
    • 100% EtOH 2x 2min
    • 95% EtOH 3x 2min
    • 70% EtOH 1x 2min
    • 50% EtOH 1x 2min
    • H2O 2x 3min
  • Blocking peroxidase activity
    • Treat in 3% H2O2-PBS for 15min on rotator at RT (240 ml/slide hold chamber).
    • Wash with PBS 3x 2min.
  • Antigen retrieval
    • Citrate buffer stock solution 100x, pH6.0 working solution 0.01M, freshly diluted into working solution.
    • Boil Citrate buffer until 100°C on hot plate, put slides in the boiled buffer, keep boiling 15min, then let them cool down on bench top for 20min.
    • Wash with H2O 2x 2min.
    • Wash with PBS 3x 5min.
    • PAP-pen cycles the slides: using vacuum to suck off the solution by cycling around the tissue area, then using the PAP-pen draw along the cycle line. Make sure the tissue area is kept wet.
  • Apply blocking solution
    • Incubate with 50-100µl (cover the whole tissue area) 5% donkey serum in PBS for 1h in moist a box at RT.
    • Blocking stock solution: 5% donkey serum in 10 ml PBS.
    • Drain blocking solution and blot excess liquid with Kim wipe.
    • Prepare primary antibody solution in blocking buffer.
  • Apply primary antibody
    • Dilute primary TMEM173 antibody ABIN3043423 1:500 dilution in 5% normal goat serum in PBS.
    • Incubate overnight in a box at 4°C to assure amoist environment and prevent slides from drying.
  • Wash with 0.05% Tween-PBS3x 5min.
  • Dilute Biotin-SP-AffinPure Donkey-anti-rabbit IgG (H+L) secondary antibody with 5% blocking solution (5% donkey serum)
  • Incubate 1h with secondary antibody at room temperature.
  • Prepare ABC solution 1:200: dilute both A and B in 0.05% Tween-PBS. Allow ABC diluted solution to sit for 30-60min before using, keep in the dark.
  • Wash with 0.05% Tween-PBS 5min, 7min, and 7min.
  • Apply 250µL/slide ABC solution; incubate for 30min at RT in moist incubation box.
  • Wash with 0.05% Tween-PBS 5min, 7min, and 7min.
  • Filter Hematoxylin.
  • Prepare fresh DAB solution in disposable beaker (do not allow solution to sit):
    • 2.5ml H2O + 1 drop buffer + 2 drops DAB + 1 drop H2O2
    • Use transfer pipette to apply DAB x 1min
  • Wash 3x with dH2O (10 dips each).
  • Hematoxylin stain 5-10sec.
  • Wash until water is clear.
  • Hematoxylin stain 5-10sec.
  • Dehydrate
    • 50% EtOH 1x 2min.
    • 70% EtOH 1x 2min.
    • 95% EtOH 2x 2min.
    • 100% EtOH 2x 2min.
    • Xylene 3x 5min.
  • Apply cover-slip. Allow glue to dry overnight.
Validierungsbilder
Immunohistochemistry validation image for anti-Transmembrane Protein 173 (TMEM173) (AA 284-316), (C-Term) antibody (ABIN3043423) Immunohistochemistry on pancreatic adenocarcinoma (PDAC) FFPE tissue sections. The pr...