anti-Human PGLYRP2 Antikörper für Western Blotting

Recommended PGLYRP2 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Peptidoglycan Recognition Protein 2 (PGLYRP2) Antikörper
  • pgrp-l
  • PGLYRP2
  • HMFT0141
  • PGLYRPL
  • PGRP-L
  • PGRPL
  • TAGL-like
  • tagL
  • tagL-alpha
  • tagl-beta
  • C730002N09Rik
  • Pglyrpl
  • pPGRP-LB
  • peptidoglycan recognition protein 2
  • pglyrp2
  • PGLYRP2
  • Pglyrp2
Reaktivität
Human
25
23
Wirt
Kaninchen
23
18
5
Klonalität
Polyklonal
Konjugat
Dieser PGLYRP2 Antikörper ist unkonjugiert
3
3
3
3
3
3
3
3
3
3
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
23
18
11
4
3
3
2
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4345109
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
3.2190244 ABIN4345111 ICC IF WB Rabbit Anmelden zum Anzeigen Polyclonal
3.2190244 ABIN5533302 WB Rabbit Ig Fraction AA 75-107 Anmelden zum Anzeigen Polyclonal
1 ABIN333120 ELISA WB Mouse IgG1, kappa Anmelden zum Anzeigen
1 ABIN4345110 ICC IF WB Rabbit Anmelden zum Anzeigen Polyclonal
1 ABIN2583444 ELISA IHC (p) WB HRP Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2583445 ELISA IHC (p) WB Biotin Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2583447 ELISA IHC (p) WB FITC Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN1993251 ELISA WB Biotin Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN1993252 ELISA WB FITC Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN1993253 ELISA WB HRP Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN5008731 WB Mouse IgG1 kappa Anmelden zum Anzeigen 45G1
1 ABIN1993254 ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN597049 ELISA WB Mouse IgG1, kappa Anmelden zum Anzeigen
1 ABIN2334144 ELISA WB Mouse IgG1 kappa Anmelden zum Anzeigen 10K303
1 ABIN2148926 ELISA WB Mouse IgG1 kappa Anmelden zum Anzeigen 45G1
1 ABIN3061263 IHC WB Rabbit Anmelden zum Anzeigen Polyclonal

General

Antigen Peptidoglycan Recognition Protein 2 (PGLYRP2) Antikörper
Reaktivität Human
(25), (23)
Wirt Kaninchen
(23), (18), (5)
Klonalität
Polyklonal
Konjugat Dieser PGLYRP2 Antikörper ist unkonjugiert
(3), (3), (3), (3), (3), (3), (3), (3), (3), (3)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(23), (18), (11), (4), (3), (3), (2)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-PGLYRP2 Antikörper

Target Details PGLYRP2 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: LMSAPNSGPHNRLYHFLLGAWSLNATELDPCPLSPELLGLTKEVARHDVREGKEYGVVLAPDGSTVAVEPLLAGLEAGLQGRRVINLPLDSMAAPWETGDTFPDVVA
Isotyp IgG

Target Details PGLYRP2

Produktdetails anti-PGLYRP2 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung PGLYRP2/PGRP-L (PGLYRP2 Antibody Abstract)
Hintergrund Gene Symbol: PGLYRP2
Gen-ID 114770
UniProt Q96PD5
Pathways Activation of Innate immune Response, Glycosaminoglycan Metabolic Process

Anwendungsinformationen

Produktdetails anti-PGLYRP2 Antikörper Target Details PGLYRP2 Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-PGLYRP2 Antikörper Target Details PGLYRP2 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-PGLYRP2 Antikörper Target Details PGLYRP2 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-Peptidoglycan Recognition Protein 2 (PGLYRP2) antibody (ABIN4345109) Immunohistochemistry: PGRPL Antibody [NBP2-32042] - Immunohistochemical staining of h...
Western Blotting (WB) image for anti-Peptidoglycan Recognition Protein 2 (PGLYRP2) antibody (ABIN4345109) Western Blot: PGRPL Antibody [NBP2-32042] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55...
Western Blotting (WB) image for anti-Peptidoglycan Recognition Protein 2 (PGLYRP2) antibody (ABIN4345109) Western Blot: PGRPL Antibody [NBP2-32042] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55...