anti-Human PGLYRP2 Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended PGLYRP2 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Peptidoglycan Recognition Protein 2 (PGLYRP2) Antikörper
  • pgrp-l
  • PGLYRP2
  • HMFT0141
  • PGLYRPL
  • PGRP-L
  • PGRPL
  • TAGL-like
  • tagL
  • tagL-alpha
  • tagl-beta
  • C730002N09Rik
  • Pglyrpl
  • pPGRP-LB
  • peptidoglycan recognition protein 2
  • pglyrp2
  • PGLYRP2
  • Pglyrp2
Reaktivität
Human
25
23
Wirt
Kaninchen
23
18
5
Klonalität
Polyklonal
Konjugat
Dieser PGLYRP2 Antikörper ist unkonjugiert
3
3
3
3
3
3
3
3
3
3
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
23
19
11
4
3
3
2
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4345108
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN4345109 IHC IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2583444 ELISA IHC (p) WB HRP Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2583445 ELISA IHC (p) WB Biotin Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2583447 ELISA IHC (p) WB FITC Rabbit IgG Anmelden zum Anzeigen Polyclonal

General

Antigen Peptidoglycan Recognition Protein 2 (PGLYRP2) Antikörper
Reaktivität Human
(25), (23)
Wirt Kaninchen
(23), (18), (5)
Klonalität
Polyklonal
Konjugat Dieser PGLYRP2 Antikörper ist unkonjugiert
(3), (3), (3), (3), (3), (3), (3), (3), (3), (3)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(23), (19), (11), (4), (3), (3), (2)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-PGLYRP2 Antikörper

Target Details PGLYRP2 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: VWGTLVLLQRLEPVHLQLQCMSQEQLAQVAANATKEFTEAFLGCPAIHPRCRWGAAPYRGRPKLLQLPLGFLYVHHTYVP
Isotyp IgG

Target Details PGLYRP2

Produktdetails anti-PGLYRP2 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung PGLYRP2/PGRP-L (PGLYRP2 Antibody Abstract)
Hintergrund Gene Symbol: PGLYRP2
Gen-ID 114770
UniProt Q96PD5
Pathways Activation of Innate immune Response, Glycosaminoglycan Metabolic Process

Anwendungsinformationen

Produktdetails anti-PGLYRP2 Antikörper Target Details PGLYRP2 Handhabung Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-PGLYRP2 Antikörper Target Details PGLYRP2 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-PGLYRP2 Antikörper Target Details PGLYRP2 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-Peptidoglycan Recognition Protein 2 (PGLYRP2) antibody (ABIN4345108) Immunohistochemistry: PGLYRP2/PGRP-L Antibody [NBP2-31930] - Immunohistochemical stai...
Immunohistochemistry (IHC) image for anti-Peptidoglycan Recognition Protein 2 (PGLYRP2) antibody (ABIN4345108) Immunohistochemistry: PGLYRP2/PGRP-L Antibody [NBP2-31930] - Immunohistochemical stai...