anti-Human LSM14A Antikörper für Immunohistochemistry

Recommended LSM14A Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
LSM14A, SCD6 Homolog A (S. Cerevisiae) (LSM14A) Antikörper
  • fam61a
  • lsm14a
  • wu:fj52e11
  • zgc:63681
  • zgc:66203
  • zgc:77302
  • RAP55A
  • rap55
  • FAM61A
  • 2700023B17Rik
  • AA407828
  • AU017544
  • Tral
  • RAP55
  • RAP55A-A
  • rap55a
  • xRAP55
  • xRAP55A
  • C19orf13
  • RGD1305695
  • LSM14 homolog Aa (SCD6, S. cerevisiae)
  • LSM14A, SCD6 homolog A
  • LSM14A, SCD6 homolog A (S. cerevisiae)
  • LSM14 homolog A (SCD6, S. cerevisiae)
  • lsm14aa
  • lsm14a
  • LSM14A
  • Lsm14a
  • lsm14a-a
Reaktivität
Human
44
12
12
4
4
4
3
3
3
2
1
1
Wirt
Kaninchen
41
3
Klonalität
Polyklonal
Konjugat
Dieser LSM14A Antikörper ist unkonjugiert
2
2
2
2
2
2
Applikation
Immunohistochemistry (IHC), Western Blotting (WB)
42
26
18
4
1
1
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4891109
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN2786131 IHC WB Rabbit C-Term Anmelden zum Anzeigen Polyclonal
1 ABIN1873569 IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN4331745 ICC IF IHC IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2624993 ELISA IHC WB Rabbit IgG AA 310-340 Anmelden zum Anzeigen Polyclonal
1 ABIN1910814 IHC ELISA WB HRP Rabbit IgG AA 311-340 Anmelden zum Anzeigen Polyclonal
1 ABIN1910809 IHC ELISA WB Alkaline Phosphatase (AP) Rabbit IgG AA 311-340 Anmelden zum Anzeigen Polyclonal
1 ABIN1910813 IHC ELISA WB PE Rabbit IgG AA 311-340 Anmelden zum Anzeigen Polyclonal
1 ABIN1910811 IHC ELISA WB Biotin Rabbit IgG AA 311-340 Anmelden zum Anzeigen Polyclonal
1 ABIN1910812 IHC ELISA WB FITC Rabbit IgG AA 311-340 Anmelden zum Anzeigen Polyclonal
1 ABIN1910810 IHC ELISA WB APC Rabbit IgG AA 311-340 Anmelden zum Anzeigen Polyclonal
1 ABIN2880681 IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2304232 IHC ELISA WB HRP Rabbit IgG C-Term, AA 310-340 Anmelden zum Anzeigen Polyclonal
1 ABIN2304233 IHC ELISA WB PE Rabbit IgG C-Term, AA 310-340 Anmelden zum Anzeigen Polyclonal
1 ABIN2304234 IHC ELISA WB Rabbit IgG C-Term, AA 310-340 Anmelden zum Anzeigen Polyclonal
1 ABIN2304236 IHC ELISA WB APC Rabbit IgG C-Term, AA 310-340 Anmelden zum Anzeigen Polyclonal
1 ABIN2304231 IHC ELISA WB FITC Rabbit IgG C-Term, AA 310-340 Anmelden zum Anzeigen Polyclonal
1 ABIN1088222 IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN1088221 IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2304235 IHC ELISA WB Alkaline Phosphatase (AP) Rabbit IgG C-Term, AA 310-340 Anmelden zum Anzeigen Polyclonal
1 ABIN2304237 IHC ELISA WB Biotin Rabbit IgG C-Term, AA 310-340 Anmelden zum Anzeigen Polyclonal

General

Antigen LSM14A, SCD6 Homolog A (S. Cerevisiae) (LSM14A) Antikörper
Reaktivität Human
(44), (12), (12), (4), (4), (4), (3), (3), (3), (2), (1), (1)
Wirt Kaninchen
(41), (3)
Klonalität
Polyklonal
Konjugat Dieser LSM14A Antikörper ist unkonjugiert
(2), (2), (2), (2), (2), (2)
Applikation Immunohistochemistry (IHC), Western Blotting (WB)
(42), (26), (18), (4), (1), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-LSM14A Antikörper

Target Details LSM14A Anwendungsinformationen Handhabung Bilder
Reinigung Immunogen affinity purified
Immunogen Synthetic peptides corresponding to LSM14A(LSM14A, SCD6 homolog A (S. cerevisiae)) The peptide sequence was selected from the middle region of LSM14A. Peptide sequence KLEKQEKPVNGEDKGDSGVDTQNSEGNADEEDPLGPNCYYDKTKSFFDNI.

Target Details LSM14A

Produktdetails anti-LSM14A Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung LSM14A (LSM14A Antibody Abstract)
Hintergrund Gene Symbol: LSM14A
Gen-ID 26065
UniProt Q8ND56
Forschungsgebiet DNA/RNA, Immunology
Pathways Activation of Innate immune Response, Ribonucleoprotein Complex Subunit Organization

Anwendungsinformationen

Produktdetails anti-LSM14A Antikörper Target Details LSM14A Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100-1:2000, ImmunohistochemistryThis is a rabbit polyclonal antibody against LSM14A and was validated on Western blot.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-LSM14A Antikörper Target Details LSM14A Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-LSM14A Antikörper Target Details LSM14A Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-LSM14A, SCD6 Homolog A (S. Cerevisiae) (LSM14A) antibody (ABIN4891109) Immunohistochemistry: LSM14A Antibody [NBP1-56784] - Formalin Fixed Paraffin Embedded...
Western Blotting (WB) image for anti-LSM14A, SCD6 Homolog A (S. Cerevisiae) (LSM14A) antibody (ABIN4891109) Western Blot: LSM14A Antibody [NBP1-56784] - Human Fetal Heart, Antibody Dilution: 1....
Western Blotting (WB) image for anti-LSM14A, SCD6 Homolog A (S. Cerevisiae) (LSM14A) antibody (ABIN4891109) Western Blot: LSM14A Antibody [NBP1-56784] - Reccomended Titration: 0.2 - 1 ug/ml ELI...
Western Blotting (WB) image for anti-LSM14A, SCD6 Homolog A (S. Cerevisiae) (LSM14A) antibody (ABIN4891109) Western Blot: LSM14A Antibody [NBP1-56784] - 721_B Cell Lysate 1.0ug/ml, Gel Concentr...
Western Blotting (WB) image for anti-LSM14A, SCD6 Homolog A (S. Cerevisiae) (LSM14A) antibody (ABIN4891109) Western Blot: LSM14A Antibody [NBP1-56784] - Sample Type: Human Fetal Lung Antibody D...