anti-Human CDC5 Cell Division Cycle 5-Like (S. Pombe) Antikörper für Immunofluorescence

Recommended CDC5 Cell Division Cycle 5-Like (S. Pombe) Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
CDC5 Cell Division Cycle 5-Like (S. Pombe) (CDC5L) Antikörper
  • zgc:55853
  • CDC5L
  • CDC5
  • CDC5-LIKE
  • CEF1
  • PCDC5RP
  • dJ319D22.1
  • 1200002I02Rik
  • AA408004
  • ARABIDOPSIS THALIANA CELL DIVISION CYCLE 5
  • ARABIDOPSIS THALIANA MYB DOMAIN CELL DIVISION CYCLE 5
  • ATCDC5
  • ATMYBCDC5
  • F21M12.15
  • F21M12_15
  • cell division cycle 5
  • CDC5 cell division cycle 5-like (S. pombe)
  • cell division cycle 5-like
  • cell division cycle 5-like (S. pombe)
  • cell division cycle 5-like protein
  • cdc5l
  • CDC5L
  • Chro.50385
  • Cdc5l
  • CDC5
Reaktivität
Human
78
43
40
5
5
5
5
3
2
2
2
2
2
1
1
1
1
1
Wirt
Kaninchen
67
14
Klonalität
Polyklonal
Konjugat
Unkonjugiert
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
59
31
31
22
13
8
7
6
5
3
2
1
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4296970
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
12.14905 ABIN4296971 ICC IF IHC IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN5660825 IC IF WB Rabbit Anmelden zum Anzeigen Polyclonal
1 ABIN2881154 IF IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN1977579 IF IHC (p) Rabbit IgG AA 752-802 Anmelden zum Anzeigen Polyclonal
1 ABIN1977578 IF IHC (p) WB Rabbit IgG AA 752-802 Anmelden zum Anzeigen Polyclonal
1 ABIN2618839 DB ICC FACS IF IP WB Mouse IgG1 Anmelden zum Anzeigen 2136C1a

General

Antigen CDC5 Cell Division Cycle 5-Like (S. Pombe) (CDC5L) Antikörper
Reaktivität Human
(78), (43), (40), (5), (5), (5), (5), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Wirt Kaninchen
(67), (14)
Klonalität
Polyklonal
Konjugat Unkonjugiert
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(59), (31), (31), (22), (13), (8), (7), (6), (5), (3), (2), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails

Antigendetails Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:DLQKSEELIKKEMITMLHYDLLHHPYEPSGNKKGKTVGFGTNNSEHITYLEHNPYEKFSKEELKKAQDVLVQEMEVVKQGMSHGELSSEAYNQVWEECYSQVLYLPGQSRYTRANLASKKDRIESLEKRLEINRGHM
Isotyp IgG

Antigendetails

Produktdetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung CDC5L (CDC5L Antibody Abstract)
Hintergrund Gene Symbol: CDC5L
Gen-ID 988
Forschungsgebiet DNA/RNA, Chromatin and Nuclear Signaling
Pathways Activation of Innate immune Response, Chromatin Binding

Anwendungsinformationen

Produktdetails Antigendetails Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails Antigendetails Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails Antigendetails Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-CDC5 Cell Division Cycle 5-Like (S. Pombe) (CDC5L) antibody (ABIN4296970) Western Blot: CDC5L Antibody [NBP1-85719] - Lane 1: Marker [kDa] 250, 130, 100, 70, 5...
Immunofluorescence (IF) image for anti-CDC5 Cell Division Cycle 5-Like (S. Pombe) (CDC5L) antibody (ABIN4296970) Immunocytochemistry/Immunofluorescence: CDC5L Antibody [NBP1-85719] - Staining of hum...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-CDC5 Cell Division Cycle 5-Like (S. Pombe) (CDC5L) antibody (ABIN4296970) Immunohistochemistry-Paraffin: CDC5L Antibody [NBP1-85719] - Staining of human cerebr...