anti-Human Calreticulin 3 Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended Calreticulin 3 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Calreticulin 3 (CALR3) Antikörper
  • AtCRT1b
  • T12M4.8
  • T12M4_8
  • calreticulin 1b
  • CMH19
  • CRT2
  • CT93
  • 1700031L01Rik
  • 6330586I20Rik
  • Crt2
  • cspn
  • A. thaliana calreticulin 3
  • AtCRT3
  • CALRETICULIN 3
  • EBS2
  • EMS-MUTAGENIZED BRI1 SUPPRESSOR 2
  • PRIORITY IN SWEET LIFE 1
  • PSL1
  • T27G7.13
  • T27G7_13
  • calreticulin 3
  • calreticulin 3
  • calreticulin 1b
  • calreticulin-3
  • Calr3
  • CALR3
  • CRT1b
  • CRT3
Reaktivität
Human
80
13
10
5
4
2
2
2
2
1
1
Wirt
Kaninchen
39
39
2
Klonalität
Polyklonal
Konjugat
Unkonjugiert
4
4
3
3
3
3
3
3
3
2
1
1
1
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
50
28
20
6
4
3
3
3
2
2
2
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4287503
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
12.837162 ABIN443224 IHC (p) IHC WB Rabbit IgG Center Anmelden zum Anzeigen Polyclonal
12.837162 ABIN4287502 IHC IHC (p) Rabbit IgG Anmelden zum Anzeigen Polyclonal

General

Antigen Calreticulin 3 (CALR3) Antikörper
Reaktivität Human
(80), (13), (10), (5), (4), (2), (2), (2), (2), (1), (1)
Wirt Kaninchen
(39), (39), (2)
Klonalität
Polyklonal
Konjugat Unkonjugiert
(4), (4), (3), (3), (3), (3), (3), (3), (3), (2), (1), (1), (1)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(50), (28), (20), (6), (4), (3), (3), (3), (2), (2), (2), (1)
Pubmed 1 Publikation vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails

Antigendetails Anwendungsinformationen Handhabung Referenzen Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: SIEYDWNLTSLKKETSPAESKDWEQTKDNKAQDWEKHFLDASTSKQSDWNGDLDGDWPAPMLQKPPYQDGLKPEGIHKGVWLHRKMKNTDYLTQYDLSEF
Isotyp IgG

Antigendetails

Produktdetails Anwendungsinformationen Handhabung Referenzen Bilder zurück nach oben
Antigen
Andere Bezeichnung Calreticulin-2/CALR3 (CALR3 Antibody Abstract)
Hintergrund Gene Symbol: CALR3
Gen-ID 125972
UniProt Q96L12
Pathways Activation of Innate immune Response

Anwendungsinformationen

Produktdetails Antigendetails Handhabung Referenzen Bilder zurück nach oben
Applikationshinweise Western Blot 1:500 - 1:1000, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails Antigendetails Anwendungsinformationen Referenzen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Referenzen

Produktdetails Antigendetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Maheswaran, Pedersen, Ditzel, Gjerstorff: "Lack of ADAM2, CALR3 and SAGE1 Cancer/Testis Antigen Expression in Lung and Breast Cancer." in: PLoS ONE, Vol. 10, Issue 8, pp. e0134967, 2015 (Probematerial (Species): Human). Weitere Details: Immunohistochemistry (Paraffin-embedded Sections)

Bilder

Produktdetails Antigendetails Anwendungsinformationen Handhabung Referenzen zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-Calreticulin 3 (CALR3) antibody (ABIN4287503) Western Blot: CALR3 Antibody [NBP2-33524] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Calreticulin 3 (CALR3) antibody (ABIN4287503) Immunohistochemistry-Paraffin: CALR3 Antibody [NBP2-33524] - Immunohistochemical stai...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Calreticulin 3 (CALR3) antibody (ABIN4287503) Immunohistochemistry-Paraffin: Calreticulin-2/CALR3 Antibody - Staining of human tes...